PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012443.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family NF-YA
Protein Properties Length: 291aa    MW: 31886.4 Da    PI: 9.81
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012443.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA98.57e-31165220258
    CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  ep+YVN+KQy++I++RRqk+akle+e+k   k+rkpylheSRh hAl+R+RgsgGrF
  Aco012443.1 165 EPIYVNPKQYNAIVRRRQKKAKLEAENKA-VKTRKPYLHESRHLHALKRERGSGGRF 220
                  8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.4E-33162223IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.334163223IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.2E-26165220IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-21166188IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-21197220IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MLPSRRPAFD FKHLTDGNHL VFEYLYMSKN SLEFHGNQIE QLGHQMPGPD NSLIRLNSGS  60
HQGVSKMSKD SLPEQQTLAR SGDCSSYREQ EGVQVRSALS GGKAEGTLPS SQVDYSQFAS  120
LPYPYSAPFY GGVLTPYGTP NIIHADMVGV APSARILPPL EPAAEPIYVN PKQYNAIVRR  180
RQKKAKLEAE NKAVKTRKPY LHESRHLHAL KRERGSGGRF LNKKQQQQQE DRSPNNNPLT  240
ETPNSSDITT VCTSGGLSNP QEHRSFSSPG FSTSHARGGN THGGNNHGPS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18165226364NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936981.12e-73PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_010936983.12e-73PREDICTED: nuclear transcription factor Y subunit A-3-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-33nuclear factor Y, subunit A6